- GPR103 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89740
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- GPR103
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: MQALNITPEQ FSRLLRDHNL TREQFIALYR LRPLVYTPEL PGRAKLA
- AQ27, GPR103, SP9155
- Human
- Rabbit
- pyroglutamylated RFamide peptide receptor
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA
Specifications/Features
Available conjugates: Unconjugated